Structure of PDB 3oqn Chain C Binding Site BS01

Receptor Information

>3oqn Chain C (length=332) Species: 1423 (Bacillus subtilis)

MNITIYDVAREANVSMATVSRVVNGNPNVKPTTRKKVLEAIERLGYRPNA
VARGLASKKTTTVGVIIPDISSIFYSELARGIEDIATMYKYNIILSNSDQ
NMEKELHLLNTMLGKQVDGIVFMGGNITDEHVAEFKRSPVPIVLAASVEE
QEETPSVAIDYEQAIYDAVKLLVDKGHTDIAFVSGPMAEPINRSKKLQGY
KRALEEANLPFNEQFVAEGDYTYDSGLEALQHLMSLDKKPTAILSATDEM
ALGIIHAAQDQGLSIPEDLDIIGFDNTRLSLMVRPQLSTVVQPTYDIGAV
AMRLLTKLMNKEPVEEHIVELPHRIELRKSTK

Ligand information

>3oqn Chain E (length=16)

ttgaaagcggtaccat

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3oqn Structures of carbon catabolite protein A-(HPr-Ser46-P) bound to diverse catabolite response element sites reveal the basis for high-affinity binding to degenerate DNA operators.
• Resolution: 3.3 Å
• Binding residue (original residue number in PDB): S16 A18 T19 R22 N29 V30 K31 T34 L56 A57 K59
• Binding residue (residue number reindexed from 1): S15 A17 T18 R21 N28 V29 K30 T33 L55 A56 K58
• Binding affinity: PDBbind-CN: Kd=3.0nM

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001216 DNA-binding transcription activator activity
• GO:0001217 DNA-binding transcription repressor activity
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:3oqn, PDBe:3oqn, PDBj:3oqn
• PDBsum: 3oqn
• PubMed: 21106498
• UniProt: P25144|CCPA_BACSU Catabolite control protein A (Gene Name=ccpA)