Structure of PDB 3on0 Chain C Binding Site BS01

Receptor Information
>3on0 Chain C (length=118) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKIQTYVNNNVYEQITDLVTIRKQEGIEEASLSNVSSMLLELGLRVYMIQ
QEKREGGFNQMEYNKLMLENVSRVRAMCTEILKMSVLNQESIASGNFDYA
VIKPAIDKFAREQVSIFF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3on0 Structural basis of cooperative DNA recognition by the plasmid conjugation factor, TraM.
Resolution2.874 Å
Binding residue
(original residue number in PDB)		S32 L33 S34 N35
Binding residue
(residue number reindexed from 1)		S31 L32 S33 N34
Binding affinityPDBbind-CN: Kd=4.8nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3on0, PDBe:3on0, PDBj:3on0
PDBsum3on0
PubMed21565799
UniProtP33788|TRAM8_ECOLX Relaxosome protein TraM (Gene Name=traM)

[Back to BioLiP]