Structure of PDB 3omh Chain C Binding Site BS01

Receptor Information
>3omh Chain C (length=294) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADKTYPTTVAE
KPKNIKKNRYKDILPYDYSRVELSLITSDEDSSYINANFIKGVYGPKAYI
ATQGPLSTTLLDFWRMIWEYSVLIIVMACMEYEMGKKKCERYWAEPGEMQ
LEFGPFSVSCEAEKRKSDYIIRTLKVKFNSETRTIYQFHYKNWPDHDVPS
SIDPILELIWDVRCYQEDDSVPICIHSSAGCGRTGVICAIDYTWMLLKDG
IIPENFSVFSLIREMRTQRPSLVQTQEQYELVYNAVLELFKRQM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3omh Substrate Specificity of Lymphoid-specific Tyrosine Phosphatase (Lyp) and Identification of Src Kinase-associated Protein of 55 kDa Homolog (SKAP-HOM) as a Lyp Substrate.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		Y60 K61 D62 I63 K136 S227 S228 A229 G230 R233 Q274
Binding residue
(residue number reindexed from 1)		Y60 K61 D62 I63 K136 S227 S228 A229 G230 R233 Q274
Enzymatic activity
Catalytic site (original residue number in PDB) D195 S227 R233 T234 Q274
Catalytic site (residue number reindexed from 1) D195 S227 R233 T234 Q274
Enzyme Commision number 3.1.3.48: protein-tyrosine-phosphatase.
Gene Ontology
Molecular Function
GO:0004725 protein tyrosine phosphatase activity
GO:0004726 non-membrane spanning protein tyrosine phosphatase activity
Biological Process
GO:0006470 protein dephosphorylation
GO:0016311 dephosphorylation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3omh, PDBe:3omh, PDBj:3omh
PDBsum3omh
PubMed21719704
UniProtQ9Y2R2|PTN22_HUMAN Tyrosine-protein phosphatase non-receptor type 22 (Gene Name=PTPN22)

[Back to BioLiP]