Structure of PDB 3o62 Chain C Binding Site BS01

Receptor Information
>3o62 Chain C (length=105) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPK
Ligand information
>3o62 Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcaccgtgattcccctcaacatcggaaaactacctc
gtcaaaggtttatgtgaaaaccatcttagacgtccacctataacta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3o62 Consequences of Cisplatin binding on nucleosome structure and dynamics.
Resolution3.216 Å
Binding residue
(original residue number in PDB)		A14 K15 R17 R20 R29 R32 R42 R77
Binding residue
(residue number reindexed from 1)		A1 K2 R4 R7 R16 R19 R29 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3o62, PDBe:3o62, PDBj:3o62
PDBsum3o62
PubMed21168769
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]