Structure of PDB 3ntw Chain C Binding Site BS01

Receptor Information
>3ntw Chain C (length=56) Species: 10116 (Rattus norvegicus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALGERLYPRVQAMQPAFASKITGMLLELSPAQLLLLLASEDSLRARVEEA
MELIVA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ntw The MLLE domain of the ubiquitin ligase UBR5 binds to its catalytic domain to regulate substrate binding.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y2388 A2397 F2398 A2399 S2400
Binding residue
(residue number reindexed from 1)		Y7 A16 F17 A18 S19
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3ntw, PDBe:3ntw, PDBj:3ntw
PDBsum3ntw
PubMed26224628
UniProtQ62671|UBR5_RAT E3 ubiquitin-protein ligase UBR5 (Gene Name=Ubr5)

[Back to BioLiP]