Structure of PDB 3nnh Chain C Binding Site BS01

Receptor Information
>3nnh Chain C (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCF
VTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPAD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3nnh Structural Insights into RNA Recognition by the Alternate-Splicing Regulator CUG-Binding Protein 1.
Resolution2.7501 Å
Binding residue
(original residue number in PDB)
K17 F19 G21 Q22 L48 K59 C61 F63 Q93 K95 A97 D98
Binding residue
(residue number reindexed from 1)
K4 F6 G8 Q9 L35 K46 C48 F50 Q80 K82 A84 D85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Cellular Component
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3nnh, PDBe:3nnh, PDBj:3nnh
PDBsum3nnh
PubMed20947024
UniProtQ92879|CELF1_HUMAN CUGBP Elav-like family member 1 (Gene Name=CELF1)

[Back to BioLiP]