Structure of PDB 3n7y Chain C Binding Site BS01

Receptor Information
>3n7y Chain C (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPHPWFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGND
VQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3n7y Thermodynamic and Structural Effects of Macrocyclization as a Constraining Method in Protein-Ligand Interactions.
Resolution2.02 Å
Binding residue
(original residue number in PDB)		R67 R86 S88 E89 S90 S96 H107 F108 K109 L120 W121
Binding residue
(residue number reindexed from 1)		R13 R32 S34 E35 S36 S42 H53 F54 K55 L66 W67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3n7y, PDBe:3n7y, PDBj:3n7y
PDBsum3n7y
PubMed21116482
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]