Structure of PDB 3lwv Chain C Binding Site BS01

Receptor Information
>3lwv Chain C (length=120) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPSYVKFEVPKELAEKALQAVEIARDTGKIRKGTNETTKAVERGQAKLVI
IAEDVDPEEIVAHLPPLCEEKEIPYIYVPSKKELGAAAGIEVAAASVAII
EPGKARDLVEEIAMKVKELM
Ligand information
>3lwv Chain D (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggccacggaaaccgcgcgcggugaucaaugagccgcguucgcucccgug
gcccacaa
<<<<<<<<<.......<<<<<<<.........>>>>>>>......>>>>>
>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3lwv Functional and Structural Impact of Target Uridine Substitutions on the H/ACA Ribonucleoprotein Particle Pseudouridine Synthase .
Resolution2.499 Å
Binding residue
(original residue number in PDB)
R34 K35 G36 T37 N38 E39 K42 R46 V58 D59 E94 V95 A96 A97 A98
Binding residue
(residue number reindexed from 1)
R31 K32 G33 T34 N35 E36 K39 R43 V55 D56 E91 V92 A93 A94 A95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006364 rRNA processing
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3lwv, PDBe:3lwv, PDBj:3lwv
PDBsum3lwv
PubMed20575532
UniProtQ8U160|RL7A_PYRFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]