Structure of PDB 3laj Chain C Binding Site BS01

Receptor Information
>3laj Chain C (length=149) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELG
AVKLRGADGGTGIYVVPEVSGGTDRMARLLGELLVSTDDSGNLAVLRTPP
GAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3laj crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression.
Resolution2.306 Å
Binding residue
(original residue number in PDB)
R21 T52 T55 R58
Binding residue
(residue number reindexed from 1)
R7 T38 T41 R44
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0034618 arginine binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006525 arginine metabolic process
GO:0006526 L-arginine biosynthetic process
GO:0051259 protein complex oligomerization
GO:1900079 regulation of arginine biosynthetic process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3laj, PDBe:3laj, PDBj:3laj
PDBsum3laj
PubMed20382162
UniProtP9WPY9|ARGR_MYCTU Arginine repressor (Gene Name=argR)

[Back to BioLiP]