Structure of PDB 3kwq Chain C Binding Site BS01

Receptor Information
>3kwq Chain C (length=107) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQS
VLLPKKT
Ligand information
>3kwq Chain I (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagcggaattccgctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kwq Structural characterization of H3K56Q nucleosomes and nucleosomal arrays.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
T16 R17 R20 G28 R29 R32 R42 K74 R77
Binding residue
(residue number reindexed from 1)
T3 R4 R7 G15 R16 R19 R29 K61 R64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function

View graph for
Cellular Component
External links
PDB RCSB:3kwq, PDBe:3kwq, PDBj:3kwq
PDBsum3kwq
PubMed20100606
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]