Structure of PDB 3kl8 Chain C Binding Site BS01

Receptor Information

>3kl8 Chain C (length=256) Species: 6239 (Caenorhabditis elegans)

KFSDNYDVKEELSVVRRCVHKTTGLEFAAKIINTDFQKLEREARICRKLQ
HPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQ
ILESIAYCHSNGIVHRNLKPENLLLASKAKGAAVKLADFGLAIEVNDSEA
WHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQH
RLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVP
WICNRE

Ligand information

>3kl8 Chain H (length=17) Species: 10116 (Rattus norvegicus)

KRPPKLGQIGRSKRVVI

Receptor-Ligand Complex Structure

Structure summary

• PDB: 3kl8 Intersubunit capture of regulatory segments is a component of cooperative CaMKII activation.
• Resolution: 3.372 Å
• Binding residue (original residue number in PDB): E96 F98 K137 E139 D156 F172 A173 G174 T175 G208 P210 P211 W213 D230 E235
• Binding residue (residue number reindexed from 1): E78 F80 K119 E121 D138 F154 A155 G156 T157 G190 P192 P193 W195 D212 E217

Enzymatic activity

• Catalytic site (original residue number in PDB): N135 K137 E139 N140 D156 T175
• Catalytic site (residue number reindexed from 1): N117 K119 E121 N122 D138 T157
• Enzyme Commision number: 2.7.11.17: calcium/calmodulin-dependent protein kinase.

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:3kl8, PDBe:3kl8, PDBj:3kl8
• PDBsum: 3kl8
• PubMed: 20139983
• UniProt: O62305|KCC2D_CAEEL Calcium/calmodulin-dependent protein kinase type II (Gene Name=unc-43)