Structure of PDB 3kf9 Chain C Binding Site BS01

Receptor Information
>3kf9 Chain C (length=149) Species: 3190 (Scherffelia dubia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMI
ADIDKDGSGTIDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDETGKISF
KNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEFFRIMKKTSLF
Ligand information
>3kf9 Chain D (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RRWKKNFIAVSAANRFKKISS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3kf9 Structural features of the complexes formed by Scherffelia dubia centrin
Resolution2.6 Å
Binding residue
(original residue number in PDB)		E28 E31 A32 F36 L49 M53 F58 K67 M68 D71 M88 M89 E101 A105 E131 M141 A145 M162
Binding residue
(residue number reindexed from 1)		E9 E12 A13 F17 L30 M34 F39 K48 M49 D52 M69 M70 E82 A86 E112 M122 A126 M143
Enzymatic activity
Catalytic site (original residue number in PDB) A52
Catalytic site (residue number reindexed from 1) A33
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding

View graph for
Molecular Function
External links
PDB RCSB:3kf9, PDBe:3kf9, PDBj:3kf9
PDBsum3kf9
PubMed
UniProtQ06827|CATR_SCHDU Caltractin

[Back to BioLiP]