Structure of PDB 3k0j Chain C Binding Site BS01

Receptor Information
>3k0j Chain C (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRG
QAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKT
Ligand information
>3k0j Chain F (length=87) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcgacucggggugcccuccauugcacuccggaggcugagaaauacccgua
ucaccugaucuggauaaugccagcguagggaagucgc
<<<<<<<<<<..<<<.<<<..........>>>>>>.........>>>>..
...<<<...<<<<......>>>>...>>>..>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3k0j Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		E425 K428
Binding residue
(residue number reindexed from 1)		E22 K25
Binding affinityPDBbind-CN: Kd=8.65nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3k0j, PDBe:3k0j, PDBj:3k0j
PDBsum3k0j
PubMed19948769
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]