Structure of PDB 3jxb Chain C Binding Site BS01

Receptor Information
>3jxb Chain C (length=67) Species: 10754 (Lederbergvirus P22) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NTQLMGERIRARRKKLKIRQAALGKMVGVSNVAISQWERSETEPNGENLL
ALSKALQCSPDYLLKGD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jxb Sequence Recognition of DNA by Protein-Induced Conformational Transitions
Resolution1.67 Å
Binding residue
(original residue number in PDB)		S31 V33 Q37 W38 T43 E44 P45 N46 N49
Binding residue
(residue number reindexed from 1)		S30 V32 Q36 W37 T42 E43 P44 N45 N48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3jxb, PDBe:3jxb, PDBj:3jxb
PDBsum3jxb
PubMed20053356
UniProtP69202|RPC2_BPP22 Repressor protein C2 (Gene Name=C2)

[Back to BioLiP]