Structure of PDB 3iwn Chain C Binding Site BS01

Receptor Information
>3iwn Chain C (length=91) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAK
Ligand information
>3iwn Chain A (length=93) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cacgcacagggcaaaccauucgaaagagugggacgcaaagccuccggccu
aaacggcauugcacuccgccguagguagcgggguuaccgaugg
<<<<......<<...<<<<<<....>>>>>>...>>...<<<.<<<<<<<
..<<<<<..........>>>>>>>>>..>>>>>>...>>.>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3iwn Recognition of the bacterial second messenger cyclic diguanylate by its cognate riboswitch.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Y808 N810 N811 E814 K817 S843 L844 K845 M846 R847 G848 Q849 F851 Q880 K883 T884 S886 D887
Binding residue
(residue number reindexed from 1)		Y8 N10 N11 E14 K17 S43 L44 K45 M46 R47 G48 Q49 F51 Q80 K83 T84 S86 D87
Binding affinityPDBbind-CN: Kd=1nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3iwn, PDBe:3iwn, PDBj:3iwn
PDBsum3iwn
PubMed19898478
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]