Structure of PDB 3irr Chain C Binding Site BS01

Receptor Information
>3irr Chain C (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQ
KEAGTPPLWKIA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3irr Crystal structure of a junction between two Z-DNA helices.
Resolution2.65 Å
Binding residue
(original residue number in PDB)		K170 N173 Y177 P192
Binding residue
(residue number reindexed from 1)		K34 N37 Y41 P56
Enzymatic activity
Enzyme Commision number 3.5.4.37: double-stranded RNA adenine deaminase.
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity

View graph for
Molecular Function
External links
PDB RCSB:3irr, PDBe:3irr, PDBj:3irr
PDBsum3irr
PubMed20439751
UniProtP55265|DSRAD_HUMAN Double-stranded RNA-specific adenosine deaminase (Gene Name=ADAR)

[Back to BioLiP]