Structure of PDB 3io8 Chain C Binding Site BS01

Receptor Information
>3io8 Chain C (length=146) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSMSQSNRELVVDFLSYKLSQKGYSWSQMAAVKQALREAGDEFELRY
RRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALC
VESVDKEMQVLVSRIAAWMATYLNDHLEPWIQENGGWDTFVELYGN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3io8 Conformational changes in Bcl-2 pro-survival proteins determine their capacity to bind ligands.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		F97 Y101 A104 F105 Q111 L112 S122 Q125 V126 E129 L130 R132 D133 N136 G138 R139 F146 Y195
Binding residue
(residue number reindexed from 1)		F46 Y50 A53 F54 Q60 L61 S71 Q74 V75 E78 L79 R81 D82 N85 G87 R88 F95 Y144
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:3io8, PDBe:3io8, PDBj:3io8
PDBsum3io8
PubMed19726685
UniProtQ07817|B2CL1_HUMAN Bcl-2-like protein 1 (Gene Name=BCL2L1)

[Back to BioLiP]