Structure of PDB 3ik5 Chain C Binding Site BS01

Receptor Information
>3ik5 Chain C (length=117) Species: 388909 (Simian immunodeficiency virus - cpz) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSVRPKVPLRTMSYKLAIDMSHFIKEKGGLEGIYYSARRHRILDIYLEKE
EGIIPDWQDYTSGPGIRYPKTFGWLWKLVPVNTSQWDDPWGEVLAWKFDP
TLAYTYEAYVRYPEEFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3ik5 Pseudo-merohedral twinning and noncrystallographic symmetry in orthorhombic crystals of SIVmac239 Nef core domain bound to different-length TCRzeta fragments.
Resolution2.05 Å
Binding residue
(original residue number in PDB)
R103 G128 I132 R137 R138 I141 Y145 E149
Binding residue
(residue number reindexed from 1)
R4 G29 I33 R38 R39 I42 Y46 E50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:3ik5, PDBe:3ik5, PDBj:3ik5
PDBsum3ik5
PubMed20124696
UniProtP31818|NEF_SIVMA Protein Nef (Gene Name=nef)

[Back to BioLiP]