Structure of PDB 3hus Chain C Binding Site BS01

Receptor Information

>3hus Chain C (length=291) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDC
QDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVD
FKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPYALRVELEDW
NGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKF
FTSHKGMQFSTWDNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYYQGGT
YSKASTPNGYDNGIIWATWKTRWYSMKKTTMKIIPFNRLTI

Ligand information

>3hus Chain G (length=4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GPRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3hus Impaired protofibril formation in fibrinogen gammaN308K is due to altered D:D and "A:a" interactions.
Resolution	3.04 Å
Binding residue (original residue number in PDB)	D301 Q329 D330 K338 C339 H340 Y363 D364 R375
Binding residue (residue number reindexed from 1)	D198 Q226 D227 K235 C236 H237 Y260 D261 R272

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005102	signaling receptor binding

	Biological Process
GO:0007596	blood coagulation
GO:0030168	platelet activation
GO:0051258	protein polymerization

	Cellular Component
GO:0005577	fibrinogen complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3hus, PDBe:3hus, PDBj:3hus
PDBsum	3hus
PubMed	19650644
UniProt	P02679\|FIBG_HUMAN Fibrinogen gamma chain (Gene Name=FGG)

[Back to BioLiP]