Structure of PDB 3gs2 Chain C Binding Site BS01

Receptor Information
>3gs2 Chain C (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEIELVFRPHPTLMEKDDSAQTRYIKTSGNATVDHLSKYLAVRLALEELR
SKGESNQMNLDTEKQYTIYIATASGQFTVLDGSFSLELVSEKYWKVNKPM
ELYYAPTK
Ligand information
>3gs2 Chain D (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EVTVTDITANSITVTFREAQAAEGFFRDR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gs2 Polycomb Group Targeting through Different Binding Partners of RING1B C-Terminal Domain.
Resolution1.699 Å
Binding residue
(original residue number in PDB)		S224 E225 E227 R246 Y247 I248 K249 T250 H258 K261 Y262 R266 N322 K323 P324
Binding residue
(residue number reindexed from 1)		S1 E2 E4 R23 Y24 I25 K26 T27 H35 K38 Y39 R43 N97 K98 P99
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Cellular Component
GO:0000151 ubiquitin ligase complex

View graph for
Cellular Component
External links
PDB RCSB:3gs2, PDBe:3gs2, PDBj:3gs2
PDBsum3gs2
PubMed20696397
UniProtQ99496|RING2_HUMAN E3 ubiquitin-protein ligase RING2 (Gene Name=RNF2)

[Back to BioLiP]