Structure of PDB 3gjo Chain C Binding Site BS01

Receptor Information
>3gjo Chain C (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQR
IVDILYATDEGFVIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gjo An EB1-binding motif acts as a microtubule tip localization signal
Resolution2.5 Å
Binding residue
(original residue number in PDB)		L221 R222 E225 Y247 T249 G252 F253 V254 P256
Binding residue
(residue number reindexed from 1)		L30 R31 E34 Y56 T58 G61 F62 V63 P65
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008017 microtubule binding

View graph for
Molecular Function
External links
PDB RCSB:3gjo, PDBe:3gjo, PDBj:3gjo
PDBsum3gjo
PubMed19632184
UniProtQ15691|MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 (Gene Name=MAPRE1)

[Back to BioLiP]