Structure of PDB 3g03 Chain C Binding Site BS01

Receptor Information
>3g03 Chain C (length=83) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIV
YCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3g03 High affinity interaction of the p53 peptide-analogue with human Mdm2 and Mdmx.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		K51 L54 L57 G58 I61 M62 Q72 H73 V93 H96 Y100
Binding residue
(residue number reindexed from 1)		K26 L29 L32 G33 I36 M37 Q47 H48 V68 H71 Y75
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3g03, PDBe:3g03, PDBj:3g03
PDBsum3g03
PubMed19305137
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]