Structure of PDB 3edr Chain C Binding Site BS01

Receptor Information
>3edr Chain C (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKCF
RSLGFDVIVYNDCSCAKMQDLLKKASEEDHTNAACFACILLSHGEENVIY
GKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQ
Ligand information
>3edr Chain F (length=5) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LDESD
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3edr Structural basis for executioner caspase recognition of P5 position in substrates.
Resolution2.45 Å
Binding residue
(original residue number in PDB)
R387 H444 Q484 C486
Binding residue
(residue number reindexed from 1)
R36 H93 Q133 C135
Enzymatic activity
Catalytic site (original residue number in PDB) G385 V386 H444 G445 C486
Catalytic site (residue number reindexed from 1) G34 V35 H93 G94 C135
Enzyme Commision number 3.4.22.60: caspase-7.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:3edr, PDBe:3edr, PDBj:3edr
PDBsum3edr
PubMed18780184
UniProtP55210|CASP7_HUMAN Caspase-7 (Gene Name=CASP7)

[Back to BioLiP]