Structure of PDB 3e2h Chain C Binding Site BS01

Receptor Information
>3e2h Chain C (length=110) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYG
AGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYF
GAGTRLSVLS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3e2h Distinct CDR3 Conformations in TCRs Determine the Level of Cross-Reactivity for Diverse Antigens, but Not the Docking Orientation
Resolution3.8 Å
Binding residue
(original residue number in PDB)		N30 Y50 G96 G97 G98
Binding residue
(residue number reindexed from 1)		N29 Y49 G94 G95 G96
Enzymatic activity
Enzyme Commision number ?
External links