Structure of PDB 3dxd Chain C Binding Site BS01

Receptor Information
>3dxd Chain C (length=123) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAPATLTI
LHQQTEAVLGECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPN
AASLSEAVQAACMLRYQKCLDAR
Ligand information
>3dxd Chain D (length=26) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VEPEERHLSKMQQNGYENPTYKFFEQ
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dxd Structure of the intracellular domain of the amyloid precursor protein in complex with Fe65-PTB2.
Resolution2.2 Å
Binding residue
(original residue number in PDB)
V559 R607 L609 S610 F611 L612 A613 V614 G615 R616 A644 E648 Q651 C654 Y658 C661 R665
Binding residue
(residue number reindexed from 1)
V17 R65 L67 S68 F69 L70 A71 V72 G73 R74 A102 E106 Q109 C112 Y116 C119 R123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001540 amyloid-beta binding

View graph for
Molecular Function
External links
PDB RCSB:3dxd, PDBe:3dxd, PDBj:3dxd
PDBsum3dxd
PubMed18833287
UniProtO00213|APBB1_HUMAN Amyloid beta precursor protein binding family B member 1 (Gene Name=APBB1)

[Back to BioLiP]