Structure of PDB 3dm1 Chain C Binding Site BS01

Receptor Information
>3dm1 Chain C (length=52) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLN
SQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dm1 Structural basis of the chromodomain of Cbx3 bound to methylated peptides from histone h1 and G9a.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
L67 P70 E71
Binding residue
(residue number reindexed from 1)
L39 P42 E43
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:3dm1, PDBe:3dm1, PDBj:3dm1
PDBsum3dm1
PubMed22514736
UniProtQ13185|CBX3_HUMAN Chromobox protein homolog 3 (Gene Name=CBX3)

[Back to BioLiP]