Structure of PDB 3dd7 Chain C Binding Site BS01

Receptor Information
>3dd7 Chain C (length=122) Species: 10678 (Punavirus P1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRHISPEELIALHDANISRYGGLPGMDPGRAEAIIGRVQARVAYEEITDL
FEVSATYLVATARGYIFNDANKRTALNSALLFLRRNGVQVFDSPELADLT
VGAATGEISVSSVADTLRRLYG
Ligand information
>3dd7 Chain D (length=22) Species: 2886926 (Escherichia phage P1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALDAEFASLFDTLDSTNKEMVN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dd7 Doc of Prophage P1 Is Inhibited by Its Antitoxin Partner Phd through Fold Complementation
Resolution1.7 Å
Binding residue
(original residue number in PDB)		A11 L12 A15 N16 R19 Y20 K73 R74 L77 N78 L81 L82 R85 R86 D93 A98
Binding residue
(residue number reindexed from 1)		A11 L12 A15 N16 R19 Y20 K72 R73 L76 N77 L80 L81 R84 R85 D92 A97
Enzymatic activity
Enzyme Commision number 2.7.11.1: non-specific serine/threonine protein kinase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004674 protein serine/threonine kinase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016301 kinase activity
GO:0044024 histone H2AS1 kinase activity
GO:0106310 protein serine kinase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006417 regulation of translation
GO:0016310 phosphorylation
GO:0039604 symbiont-mediated suppression of host translation
GO:0044696 killing by virus of host cell by post-segregational killing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3dd7, PDBe:3dd7, PDBj:3dd7
PDBsum3dd7
PubMed18757857
UniProtQ06259|DOC_BPP1 Protein kinase doc (Gene Name=doc)

[Back to BioLiP]