Structure of PDB 3dab Chain C Binding Site BS01

Receptor Information
>3dab Chain C (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IQINQVRPKLPLLKILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQ
HMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRKNLV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3dab Structure of the human Mdmx protein bound to the p53 tumor suppressor transactivation domain.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		M53 G57 I60 Y66 Q71 H72 V92 P95 Y99
Binding residue
(residue number reindexed from 1)		M32 G36 I39 Y45 Q50 H51 V71 P74 Y78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3dab, PDBe:3dab, PDBj:3dab
PDBsum3dab
PubMed18677113
UniProtO15151|MDM4_HUMAN Protein Mdm4 (Gene Name=MDM4)

[Back to BioLiP]