Structure of PDB 3cal Chain C Binding Site BS01

Receptor Information
>3cal Chain C (length=87) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHE
GGQSYKIGDTWRRPHEGYMLECVCLGNGKGEWTCKPI
Ligand information
>3cal Chain D (length=18) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KGIVTGAVSDHTTVEDTK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3cal Crystal structures of fibronectin-binding sites from Staphylococcus aureus FnBPA in complex with fibronectin domains
Resolution1.7 Å
Binding residue
(original residue number in PDB)		F67 R83 W90 R99 G100 R101 I102 S103 C104 T105 I106 Y132 K143 E145 W146 T147 C148 P150
Binding residue
(residue number reindexed from 1)		F5 R21 W28 R37 G38 R39 I40 S41 C42 T43 I44 Y68 K79 E81 W82 T83 C84 P86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:3cal, PDBe:3cal, PDBj:3cal
PDBsum3cal
PubMed18713862
UniProtP02751|FINC_HUMAN Fibronectin (Gene Name=FN1)

[Back to BioLiP]