Structure of PDB 3bzl Chain C Binding Site BS01

Receptor Information
>3bzl Chain C (length=81) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PTHIAICLYYKLGETPLPLVIETGKDAKALQIIKLAELYDIPVIEDIPLA
RSLYKNIHKGQYITEDFFEPVAQLIRIAIDL
Ligand information
>3bzl Chain A (length=18) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QSGSLANNIKKSTVIVKN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bzl Structural analysis of the essential self-cleaving type III secretion proteins EscU and SpaS.
Resolution1.71 Å
Binding residue
(original residue number in PDB)		H265 I266 A267 I268 C269 L270 Y271 Y272 I283 E284 Q293 Y301 I303 P304 V305 I306 E307 D308 I309 A312 R313 L336 I337 A340
Binding residue
(residue number reindexed from 1)		H3 I4 A5 I6 C7 L8 Y9 Y10 I21 E22 Q31 Y39 I41 P42 V43 I44 E45 D46 I47 A50 R51 L74 I75 A78
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0009306 protein secretion
Cellular Component
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bzl, PDBe:3bzl, PDBj:3bzl
PDBsum3bzl
PubMed18451864
UniProtQ9AJ26

[Back to BioLiP]