Structure of PDB 3boy Chain C Binding Site BS01

Receptor Information
>3boy Chain C (length=147) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLHKERRIGRLSVLLLLNEAEESTQVEELERDGWKVCLGKVGSMDAHKVI
AAIETASKKSGVIQSEGYRESHALYHATMEALHGVTRGEMLLGSLLRTVG
LRFAVLRGNPYESEAEGDWIAVSLYGTIGAPIKGLEHETFGVGINHI
Ligand information
>3boy Chain D (length=22) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uuuaguuuuuaguuuuuaguuu
......................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3boy Crystal Structure of Activated HutP: An RNA Binding Protein that Regulates Transcription of the hut Operon in Bacillus subtilis
Resolution1.7 Å
Binding residue
(original residue number in PDB)		K41 G43 S44 A52 A53 E55 T56 A57 K60 T99 V100 G101 L102 R103 T128 A131 P132 I133 K134 E137
Binding residue
(residue number reindexed from 1)		K40 G42 S43 A51 A52 E54 T55 A56 K59 T98 V99 G100 L101 R102 T127 A130 P131 I132 K133 E136
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
Biological Process
GO:0006547 L-histidine metabolic process
GO:0010628 positive regulation of gene expression

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3boy, PDBe:3boy, PDBj:3boy
PDBsum3boy
PubMed
UniProtP10943|HUTP_BACSU Hut operon positive regulatory protein (Gene Name=hutP)

[Back to BioLiP]