Structure of PDB 3bo7 Chain C Binding Site BS01

Receptor Information
>3bo7 Chain C (length=169) Species: 5811 (Toxoplasma gondii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKGYLRIVTTQGSLNIELHADMAPRACDSFLRLCAVKYFDDTIFHRCIRN
FMIQGGRAELRQPSKKQSPRSISGFPGGAPFEDEFDNRLVHQGIGVLSMA
NDGKHSNLSEFFITFKSCEHLNNKHTIFGRVVGGLDVLRQWEKLETDKKD
KPLKPPKVEEIIVFKNPFE
Ligand information
>3bo7 Chain G (length=11) Species: 29910 (Tolypocladium inflatum) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ALLVTPGLVLA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3bo7 Crystal Structure of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136.
Resolution2.35 Å
Binding residue
(original residue number in PDB)		R50 F55 M56 Q58 A108 N109 D110 E118 F120 H128 H133
Binding residue
(residue number reindexed from 1)		R46 F51 M52 Q54 A100 N101 D102 E110 F112 H120 H125
Enzymatic activity
Catalytic site (original residue number in PDB) R50 F55 Q58 N109 F120 L129 H133
Catalytic site (residue number reindexed from 1) R46 F51 Q54 N101 F112 L121 H125
Enzyme Commision number 5.2.1.8: peptidylprolyl isomerase.
Gene Ontology
Molecular Function
GO:0003755 peptidyl-prolyl cis-trans isomerase activity
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000209 protein polyubiquitination
GO:0000413 protein peptidyl-prolyl isomerization
Cellular Component
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3bo7, PDBe:3bo7, PDBj:3bo7
PDBsum3bo7
PubMed
UniProtD0VWS5

[Back to BioLiP]