Structure of PDB 2zt9 Chain C Binding Site BS01

Receptor Information
>2zt9 Chain C (length=289) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YPFWAQQTYPETPREPTGRIVCANCHLAAKPTEVEVPQSVLPDTVFKAVV
KIPYDTSVQQVGADGSKVGLNVGAVLMLPEGFKIAPEDRIPEELKEEIGD
VYFQPYGEDKDNIVIVGPLPGEQYQEIVFPVLSPNPANDKNIHFGKYSVH
VGGNRGRGQVYPTGEKSNNNLYSAAATGTISKIAKQEGEDGSVKYLVDIK
TESGEVVSDTIPAGPELIVSEGQAVTAGDALTNNPNVGGFGQLDAEIVLQ
DANRVGWLIAFVALVMLAQVMLVLKKKQVEKVQAAEMNF
Ligand information
>2zt9 Chain H (length=29) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
MAILTLGWVSLLVVFTWSIAMVVWGRNGL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zt9 Structure-Function, Stability, and Chemical Modification of the Cyanobacterial Cytochrome b6f Complex from Nostoc sp. PCC 7120
Resolution3.0 Å
Binding residue
(original residue number in PDB)		Q38 S39 L41 T44 V255 I259 V262 M266 Q269 V270 V273 K276 K277
Binding residue
(residue number reindexed from 1)		Q38 S39 L41 T44 V255 I259 V262 M266 Q269 V270 V273 K276 K277
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zt9, PDBe:2zt9, PDBj:2zt9
PDBsum2zt9
PubMed19189962
UniProtQ93SW9|CYF_NOSS1 Cytochrome f (Gene Name=petA)

[Back to BioLiP]