Structure of PDB 2zjd Chain C Binding Site BS01

Receptor Information
>2zjd Chain C (length=122) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKT
KFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYE
SEKDEDGFLYMVYASQETFGMK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2zjd Structural Basis for Sorting Mechanism of p62 in Selective Autophagy
Resolution1.56 Å
Binding residue
(original residue number in PDB)		I23 H27 K30 P32 K51 F52 L53 I66 F108
Binding residue
(residue number reindexed from 1)		I23 H27 K30 P32 K51 F52 L53 I66 F108
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0008017 microtubule binding
GO:0008429 phosphatidylethanolamine binding
GO:0031625 ubiquitin protein ligase binding
GO:0097001 ceramide binding
Biological Process
GO:0000045 autophagosome assembly
GO:0000422 autophagy of mitochondrion
GO:0000423 mitophagy
GO:0006914 autophagy
GO:0006995 cellular response to nitrogen starvation
GO:0009267 cellular response to starvation
GO:0016236 macroautophagy
GO:0097352 autophagosome maturation
Cellular Component
GO:0000421 autophagosome membrane
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005776 autophagosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005930 axoneme
GO:0012505 endomembrane system
GO:0016020 membrane
GO:0031090 organelle membrane
GO:0031410 cytoplasmic vesicle
GO:0031966 mitochondrial membrane
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2zjd, PDBe:2zjd, PDBj:2zjd
PDBsum2zjd
PubMed18524774
UniProtQ9GZQ8|MLP3B_HUMAN Microtubule-associated proteins 1A/1B light chain 3B (Gene Name=MAP1LC3B)

[Back to BioLiP]