Structure of PDB 2z31 Chain C Binding Site BS01

Receptor Information

>2z31 Chain C (length=181) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IEADHVGSYGIVVYQSPGDIGQYTFEFDGDELFYVDLDKKETIWMLPEFA
QLRSFDPQGGLQNIATGKHNLGVLTKRSNSTPATNEAPQATVFPKSPVLL
GQPNTLICFVDNIFPPVINITWLRNSKSVADGVYETSFFVNRDYSFHKLS
YLTFIPSDDDIYDCKVEHWGLEEPVLKHWEP

Ligand information

>2z31 Chain P (length=11) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RGGASQYRPSQ

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2z31 Structural evidence for a germline-encoded T cell receptor-major histocompatibility complex interaction 'codon'
Resolution	2.7 Å
Binding residue (original residue number in PDB)	Y9 V11 F24 S53 N62 T65 H68 N69 V72
Binding residue (residue number reindexed from 1)	Y9 V12 F25 S54 N63 T66 H69 N70 V73

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2z31, PDBe:2z31, PDBj:2z31
PDBsum	2z31
PubMed	17694060
UniProt	P14438\|HA2U_MOUSE H-2 class II histocompatibility antigen, A-U alpha chain (Fragment) (Gene Name=H2-Aa)

[Back to BioLiP]