Structure of PDB 2y1l Chain C Binding Site BS01

Receptor Information
>2y1l Chain C (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTT
TFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGI
IYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y1l Caspase-8 in Complex with Darpin-8.4
Resolution1.8 Å
Binding residue
(original residue number in PDB)		R258 R260 H317 Q358 A359 C360
Binding residue
(residue number reindexed from 1)		R36 R38 H95 Q136 A137 C138
Enzymatic activity
Catalytic site (original residue number in PDB) R258 D259 H317 G318 C360 Q361
Catalytic site (residue number reindexed from 1) R36 D37 H95 G96 C138 Q139
Enzyme Commision number 3.4.22.61: caspase-8.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2y1l, PDBe:2y1l, PDBj:2y1l
PDBsum2y1l
PubMed
UniProtQ14790|CASP8_HUMAN Caspase-8 (Gene Name=CASP8)

[Back to BioLiP]