Structure of PDB 2y0n Chain C Binding Site BS01

Receptor Information
>2y0n Chain C (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TITIEIPEVLKKQLEDDCYYINRRKRLVKLPCQTNIITILESYVKHFAIN
AAFPAEKNVDLCKEMVDGLRITFDYTLPLVLLYPYEQAQYKKVTSSEFDQ
PPPPSYIYGAQHLLRLFVKLPEILGKMSFSEKNLKALLKHFDLFLRFLAE
YHDDFFPESAYVAA
Ligand information
>2y0n Chain G (length=29) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VTSFFPITPFLPVVAFGRPLPKLAPQNFE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2y0n Structural Basis for Mof and Msl3 Recruitment Into the Dosage Compensation Complex by Msl1.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		G260 L261 T264 Y267 L271 V272 L274 Y275 P276 R458 V461 K462 K469 M470 S471 F472
Binding residue
(residue number reindexed from 1)		G68 L69 T72 Y75 L79 V80 L82 Y83 P84 R115 V118 K119 K126 M127 S128 F129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006325 chromatin organization
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2y0n, PDBe:2y0n, PDBj:2y0n
PDBsum2y0n
PubMed21217699
UniProtQ8N5Y2|MS3L1_HUMAN MSL complex subunit 3 (Gene Name=MSL3)

[Back to BioLiP]