Structure of PDB 2xsd Chain C Binding Site BS01

Receptor Information
>2xsd Chain C (length=128) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEA
LQLSFKNMCKLKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITG
LADSLQLEKEVVRVWFCNRRQKEKRMTP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xsd Crystal Structure of the Dimeric Oct6 (POU3F1) POU Domain Bound to Palindromic More DNA.
Resolution2.049 Å
Binding residue
(original residue number in PDB)		Q288 T289 C292 Q298 S343 I344 N387
Binding residue
(residue number reindexed from 1)		Q42 T43 C46 Q52 S74 I75 N118
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2xsd, PDBe:2xsd, PDBj:2xsd
PDBsum2xsd
PubMed21117060
UniProtP21952|PO3F1_MOUSE POU domain, class 3, transcription factor 1 (Gene Name=Pou3f1)

[Back to BioLiP]