Structure of PDB 2xqq Chain C Binding Site BS01

Receptor Information
>2xqq Chain C (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPT
WHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xqq Directed Evolution Reveals the Binding Motif Preference of the Lc8/Dynll Hub Protein and Predicts Large Numbers of Novel Binders in the Human Proteome
Resolution1.31 Å
Binding residue
(original residue number in PDB)		E35 K36
Binding residue
(residue number reindexed from 1)		E32 K33
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0045505 dynein intermediate chain binding
Biological Process
GO:0007017 microtubule-based process
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005868 cytoplasmic dynein complex
GO:0005874 microtubule
GO:0005875 microtubule associated complex
GO:0005886 plasma membrane
GO:0005929 cilium
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0030286 dynein complex
GO:0031475 myosin V complex
GO:0097542 ciliary tip
GO:0097731 9+0 non-motile cilium
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xqq, PDBe:2xqq, PDBj:2xqq
PDBsum2xqq
PubMed21533121
UniProtQ96FJ2|DYL2_HUMAN Dynein light chain 2, cytoplasmic (Gene Name=DYNLL2)

[Back to BioLiP]