Structure of PDB 2xpj Chain C Binding Site BS01

Receptor Information
>2xpj Chain C (length=185) Species: 72539 (Physalis mottle virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SEVVKVKQASIPAPGSILSQPNTEQSPAIVLPFQFEATTFGTAETAAQVS
LQTADPITKLTAPYRHAQIVECKAILTPTDLAVSNPLTVYLAWVPANSPA
TPTQILRVYGGQSFVLGGAISAAKTIEVPLNLDSVNRMLKDSVTYTDTPK
LLAYSRAPTNPSKIPTASIQISGRIRLSKPMLIAN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xpj Crystal Structure of Natural Bottom Component of Phmv
Resolution3.4 Å
Binding residue
(original residue number in PDB)		K8 K10 E74
Binding residue
(residue number reindexed from 1)		K5 K7 E71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
Cellular Component
GO:0019028 viral capsid
GO:0039617 T=3 icosahedral viral capsid

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:2xpj, PDBe:2xpj, PDBj:2xpj
PDBsum2xpj
PubMed
UniProtP36351|COAT_PHMV Coat protein

[Back to BioLiP]