Structure of PDB 2xkv Chain C Binding Site BS01

Receptor Information
>2xkv Chain C (length=43) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAGSGMQVQDV
Ligand information
>2xkv Chain B (length=96) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
cucuguugguucucugugcucugugcucuguuuaccaggucagguccgaa
aggaagcagccaaggcagagacgcagagcaggcagauguagcuggc
.........<..........<<<...<<<<<<.....<<<..<.<<....
..>>..>.>>>..>>>>>.>...>>>..............>.....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xkv Cryo-Em Structure of the E. Coli Translating Ribosome in Complex with Srp and its Receptor.
Resolution13.5 Å
Binding residue
(original residue number in PDB)		A30 N33 M35 T36 K38 S49 R50 R53 G57 S58 G59
Binding residue
(residue number reindexed from 1)		A8 N11 M13 T14 K16 S27 R28 R31 G35 S36 G37
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2xkv, PDBe:2xkv, PDBj:2xkv
PDBsum2xkv
PubMed21151118
UniProtP0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)

[Back to BioLiP]