Structure of PDB 2xjz Chain C Binding Site BS01

Receptor Information
>2xjz Chain C (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GGCQQYWHEDCLSCDLCGCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGL
CASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINSDIV
CEQDIYEWTKIN
Ligand information
>2xjz Chain K (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DVMVVGEPTLMGGEFGDEDER
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xjz Structure of the Leukemia Oncogene Lmo2: Implications for the Assembly of a Hematopoietic Transcription Factor Complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R63 L64 Y65 Y66 K67 Y77 Q83 G85 I94 A96 Y97 E98 M99 T100 M101 R102 C123 V124 G125 D126 R127 Y128 L129
Binding residue
(residue number reindexed from 1)		R27 L28 Y29 Y30 K31 Y41 Q47 G49 I58 A60 Y61 E62 M63 T64 M65 R66 C87 V88 G89 D90 R91 Y92 L93
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2xjz, PDBe:2xjz, PDBj:2xjz
PDBsum2xjz
PubMed21076045
UniProtP25791|RBTN2_HUMAN Rhombotin-2 (Gene Name=LMO2)

[Back to BioLiP]