Structure of PDB 2x7n Chain C Binding Site BS01

Receptor Information
>2x7n Chain C (length=132) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLG
DMVMATVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANP
KGEMKGSAITGPVGKECADLWPRVASNSGVVV
Ligand information
>2x7n Chain A (length=28) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
accguauaguacgagaggaacuacgguu
<<<<<<...............>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2x7n Mechanism of Eif6-Mediated Inhibition of Ribosomal Subunit Joining.
Resolution11.8 Å
Binding residue
(original residue number in PDB)		A1 Q2 R7
Binding residue
(residue number reindexed from 1)		A1 Q2 R7
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:2x7n, PDBe:2x7n, PDBj:2x7n
PDBsum2x7n
PubMed20356839
UniProtP0CX41|RL23A_YEAST Large ribosomal subunit protein uL14A (Gene Name=RPL23A)

[Back to BioLiP]