Structure of PDB 2wub Chain C Binding Site BS01

Receptor Information
>2wub Chain C (length=228) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGSSSLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDS
VSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKG
DRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHSSSLREALVPLVADH
KCSSPEVYGADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGI
ISWGCRLHKPGVYTRVANYVDWINDRIR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wub Unraveling the Allosteric Mechanism of Serine Protease Inhibition by an Antibody
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S26 W29 P120 C122 V206 A207 I242 R243
Binding residue
(residue number reindexed from 1)		S11 W14 P112 C114 V194 A195 I227 R228
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H40 D90 Q180 G181 D182 S183 G184
Enzyme Commision number 3.4.21.-
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wub, PDBe:2wub, PDBj:2wub
PDBsum2wub
PubMed20004165
UniProtQ04756|HGFA_HUMAN Hepatocyte growth factor activator (Gene Name=HGFAC)

[Back to BioLiP]