Structure of PDB 2w65 Chain C Binding Site BS01

Receptor Information
>2w65 Chain C (length=211) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QIQLVQSGPELKKPGETVKISCKASGYTFTDYSIHWVKQAPGKGLKWMGW
INTETGEPTYTDDFKGRFAFSLESSASTAFLQINNLKNEDTATYFCARAT
TATELAYWGQGTLVTVSAAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTV
TWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPAS
STKVDKKIVPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2w65 Structure and pathogenicity of antibodies specific for citrullinated collagen type II in experimental arthritis.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		D31 Y32 S33 W50 T100 T101 E104
Binding residue
(residue number reindexed from 1)		D31 Y32 S33 W50 T100 T101 E104
External links