Structure of PDB 2vpl Chain C Binding Site BS01

Receptor Information
>2vpl Chain C (length=137) Species: 274 (Thermus thermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PKHGKRYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGID
PRRSDQNVRGTVSLPHGGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRA
FIRALEAHKPEGAKGTFLRSVYVTTTMGPSVRINPHS
Ligand information
>2vpl Chain D (length=46) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggagugaaggaggcucgcgaucgcgaagccgagaaacuucacuccc
.<<<<<<<<..<<<<<<<<..>>>>.>>>>......>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vpl Domain II of Thermus thermophilus ribosomal protein L1 hinders recognition of its mRNA.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		H3 G4 K5 R6 Y7 A35 K36 F37 T40 E42 H44 K46 D166 T168 H172 P174 S211 Y213 T217 M218 G219 S221
Binding residue
(residue number reindexed from 1)		H3 G4 K5 R6 Y7 A35 K36 F37 T40 E42 H44 K46 D75 T77 H81 P83 S120 Y122 T126 M127 G128 S130
Binding affinityPDBbind-CN: Kd=45.4nM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2vpl, PDBe:2vpl, PDBj:2vpl
PDBsum2vpl
PubMed18778715
UniProtP27150|RL1_THETH Large ribosomal subunit protein uL1 (Gene Name=rplA)

[Back to BioLiP]