Structure of PDB 2vpe Chain C Binding Site BS01

Receptor Information
>2vpe Chain C (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GAMAVYPCGICTNEVNDDQDAILCEASCQKWFHRICTGMTETAYGLLTAE
ASAVWGCDTCMA
Ligand information
>2vpe Chain D (length=29) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GAMVYVFSTEMANKAAEAVLKGQVETIVS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2vpe Decoding of Methylated Histone H3 Tail by the Pygo- Bcl9 Wnt Signaling Complex.
Resolution1.7 Å
Binding residue
(original residue number in PDB)		G373 M374 T375 T377 A378 L382 S387 A388 V389 W390 M396
Binding residue
(residue number reindexed from 1)		G38 M39 T40 T42 A43 L47 S52 A53 V54 W55 M61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2vpe, PDBe:2vpe, PDBj:2vpe
PDBsum2vpe
PubMed18498752
UniProtQ9Y3Y4|PYGO1_HUMAN Pygopus homolog 1 (Gene Name=PYGO1)

[Back to BioLiP]