Structure of PDB 2v7d Chain C Binding Site BS01

Receptor Information

>2v7d Chain C (length=226) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GSMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAY
KNVVGARRSSWRVVSSIEQKTEKKQQMAREYREKIETELRDICNDVLSLL
EKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQE
AFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIA
ELDTLEESYKDSTLIMQLLRDNLTLW

Ligand information

>2v7d Chain R (length=7) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

KSATTTV

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2v7d Beta2 Integrin Phosphorylation on Thr758 Acts as a Molecular Switch to Regulate 14-3-3 and Filamin Binding.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	K49 R56 K120 R127 Y128 N173 V176 E180 N224
Binding residue (residue number reindexed from 1)	K51 R58 K119 R126 Y127 N172 V175 E179 N222

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0050815	phosphoserine residue binding
GO:0140311	protein sequestering activity

	Biological Process
GO:0006468	protein phosphorylation
GO:0007165	signal transduction
GO:0008104	protein localization
GO:0070372	regulation of ERK1 and ERK2 cascade

	Cellular Component
GO:0005737	cytoplasm
GO:0042470	melanosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:2v7d, PDBe:2v7d, PDBj:2v7d
PDBsum	2v7d
PubMed	18550856
UniProt	P63103\|1433Z_BOVIN 14-3-3 protein zeta/delta (Gene Name=YWHAZ)

[Back to BioLiP]