Structure of PDB 2rem Chain C Binding Site BS01

Receptor Information

>2rem Chain C (length=191) Species: 2371 (Xylella fastidiosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NHLPVVGEDYVEIPDGRPFAPLAGKIEVVEIFGYTCPHCAHFDSKLQAWG
ARQAKDVRFTLVPAVFGGVWDPFARAYLAADVLGVAKRSHTAMFEAIHEK
GSVPIQNVGPDELAVFYAGYGVQPDRFVATFNGPEVEKRFQAARAYALKV
RPVGTPTIVVNGRYMVTGHDFEDTLRITDYLVSRERAASHG

Ligand information

>2rem Chain T (length=8) Species: 2371 (Xylella fastidiosa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

AAAAAGGA

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2rem Residues substitution in the active site of DSBA may compensate for the lack of the canonical motif CPHC
Resolution	1.9 Å
Binding residue (original residue number in PDB)	H40 F68 V155 G156 T157 D172 F173
Binding residue (residue number reindexed from 1)	H38 F66 V153 G154 T155 D170 F171

Enzymatic activity

Enzyme Commision number

1.8.4.2: protein-disulfide reductase (glutathione).

Gene Ontology

	Molecular Function
GO:0015036	disulfide oxidoreductase activity
GO:0016491	oxidoreductase activity

	Cellular Component
GO:0042597	periplasmic space

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:2rem, PDBe:2rem, PDBj:2rem
PDBsum	2rem
PubMed
UniProt	Q9PDE3

[Back to BioLiP]