Structure of PDB 2qos Chain C Binding Site BS01

Receptor Information

>2qos Chain C (length=173) Species: 9606 (Homo sapiens)

ASPISTIQPKANFDAQQFAGTWLLVAVGSAARFLQEQGHRAEATTLHVAP
QGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAE
TDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQI
FYFPKYGFCEAADQFHVLDEVRR

Ligand information

>2qos Chain A (length=11) Species: 9606 (Homo sapiens)

LRYDSTAERLY

Receptor-Ligand Complex Structure

Structure summary

• PDB: 2qos Crystal structure of complement protein C8gamma in complex with a peptide containing the C8gamma binding site on C8alpha: Implications for C8gamma ligand binding.
• Resolution: 1.81 Å
• Binding residue (original residue number in PDB): L33 F42 R70 W77 V79 Q81 R100 L120 K129 F162 E179
• Binding residue (residue number reindexed from 1): L24 F33 R61 W68 V70 Q72 R91 L111 K120 F153 E170

Gene Ontology

Molecular Function

• GO:0001848 complement binding
• GO:0005515 protein binding
• GO:0019841 retinol binding
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0006956 complement activation
• GO:0006957 complement activation, alternative pathway
• GO:0006958 complement activation, classical pathway
• GO:0031640 killing of cells of another organism
• GO:0050778 positive regulation of immune response

Cellular Component

• GO:0005576 extracellular region
• GO:0005579 membrane attack complex
• GO:0005615 extracellular space
• GO:0005886 plasma membrane
• GO:0070062 extracellular exosome
• GO:0072562 blood microparticle

External links

• PDB: RCSB:2qos, PDBe:2qos, PDBj:2qos
• PDBsum: 2qos
• PubMed: 17692377
• UniProt: P07360|CO8G_HUMAN Complement component C8 gamma chain (Gene Name=C8G)